LL37 5mg

£24.00

Description

Product Name: LL37
SKU: LL375
CAS Number: 154947-66-7
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Format: Lyophilised powder in a sterile glass vial
Purity: ≥98% (HPLC verified on select batches)
Availability: UK stock – ships within 1-2 business days

The LL37 5mg UK is a high-purity, research-grade 37-amino acid cathelicidin antimicrobial peptide supplied as a lyophilised powder for laboratory applications only.

LL37 ensures consistent quality for precise experimental outcomes.

Key Specifications – LL37 5mg UK

  • Molecular Weight: 4493.3 g/mol
  • Sequence: [LL-37, 37 aa]
  • Synonyms: LL-37, Human Cathelicidin, CAMP (118-154), Ropocamptide
  • Appearance: White to off-white lyophilised solid
  • Solubility: Highly soluble in sterile water or bacteriostatic water

HPLC analysis is always included and can be found in our lab analysis docs on the site.

Each batch is produced in an ISO-certified facility with direct oversight, including High-Performance Liquid Chromatography (HPLC) on selected batches to confirm purity and identity. Certificates of Analysis (HPLC) are available on request.

For Research Use Only – This product is strictly for licensed laboratory research. It is not for human or veterinary use, nor for diagnostic or therapeutic application.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Related Products

Thymosin-Beta-4

GHK-Cu Peptide

£79.99
Thymosin-Beta-4
TB-500-600x600
BPC-157-600x600

BPC-157 (10mg)

£97.00